PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG022008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NAC
Protein Properties Length: 165aa    MW: 19513.4 Da    PI: 10.2303
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG022008.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.61.6e-5571351128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                  +ppGfrFhPt+eelv +yLk+k++++k++l +vi+++d+yk+ePwd+++  k      e++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk+vl
  CCG022008.1   7 VPPGFRFHPTEEELVGYYLKRKIDSQKIDL-DVIANIDLYKMEPWDIQArcK--LgydEQNEWYFFSHKDRKYPTGTRTNRATAAGFWKATGRDKAVL 101
                  69****************************.9***************96342..3333677************************************* PP

          NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                  s k++l+g++ktLvfykgrap+g+ktdW+mheyrl
  CCG022008.1 102 S-KNRLIGMRKTLVFYKGRAPNGRKTDWIMHEYRL 135
                  *.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-573141IPR003441NAC domain
PROSITE profilePS5100554.5977165IPR003441NAC domain
PfamPF023651.5E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MQMESCVPPG FRFHPTEEEL VGYYLKRKID SQKIDLDVIA NIDLYKMEPW DIQARCKLGY  60
DEQNEWYFFS HKDRKYPTGT RTNRATAAGF WKATGRDKAV LSKNRLIGMR KTLVFYKGRA  120
PNGRKTDWIM HEYRLQTSEH GPPQASSFFI NFHNNQKKAF LKRIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-52213510140Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5999390.0AB599939.1 Populus trichocarpa PtVNS08 mRNA for transcription factor, complete cds.
GenBankHQ2158580.0HQ215858.1 Populus trichocarpa wood-associated NAC domain transcription factor 6B (WND6B) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011001778.11e-107PREDICTED: NAC domain-containing protein 7-like isoform X2
RefseqXP_011001780.11e-107PREDICTED: NAC domain-containing protein 7-like isoform X2
SwissprotQ9C8W91e-91NAC30_ARATH; NAC domain-containing protein 30
TrEMBLE5KUI21e-104E5KUI2_POPTR; Transcription factor
STRINGPOPTR_0019s11330.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-81vascular related NAC-domain protein 7